PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00406g01119.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 420aa    MW: 47621.5 Da    PI: 4.8735
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00406g01119.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.61.2e-27293343151
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                               k r+rWt++LH+rF+++v++LGG++kAtPk+il+lm+ ++Lt++hvkSHLQ
  Peaxi162Scf00406g01119.1 293 KSRIRWTEDLHDRFLDCVNHLGGADKATPKQILNLMDSEDLTIDHVKSHLQ 343
                               68************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.269290350IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-24291343IPR009057Homeodomain-like
SuperFamilySSF466891.15E-13291344IPR009057Homeodomain-like
TIGRFAMsTIGR015578.9E-23293344IPR006447Myb domain, plants
PfamPF002491.9E-5297344IPR001005SANT/Myb domain
PfamPF143792.7E-16341387IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MSIQRIVTQD RTHKNNDFAS DCTIEFSRTS AQDLVSQQLN SSYNMGYCFQ PAEGSEQQHQ  60
QTCNWPTDSS TSSTIIGLIG SPYSAFFATE RCLGLTPDDN QDNISQLINN YDLQMSTYPQ  120
HCKNAFFETI AQVEPDFPHK ISLPSEFSTQ DNTSQLTYNY DLNQDNTSQL LDHYDLQMSS  180
YPQQCRNGFL EGSTAEAEAI FQHKISLPSE FSVSQPLCPA APFSHPFGKN ELLGEFGTSY  240
RRHPLLPFDG NQNYSLSHDL CNSHLAKTRQ QSESPSLTCH NSASSGVPHK HNKSRIRWTE  300
DLHDRFLDCV NHLGGADKAT PKQILNLMDS EDLTIDHVKS HLQEALQMQL EAQRCLHEQL  360
ETQQKLQMRI EQQAKELKMI FDQQQKTSRS MLETQNSYII SSPGDPSTAH DDVEILVIED
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629806.11e-172PREDICTED: uncharacterized protein LOC104119904 isoform X1
RefseqXP_009629807.11e-172PREDICTED: uncharacterized protein LOC104119904 isoform X2
TrEMBLM1C6J91e-121M1C6J9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000608551e-120(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.19e-31G2-like family protein